PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.288590.1
Common NameCsa_1G575180, LOC101216625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 241aa    MW: 27097.1 Da    PI: 6.9029
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.288590.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52.1e-151462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed  l   ++++G+g +W + +++ g++R++k+c++rw++yl
   Cucsa.288590.1 14 RGPWSPQEDATLTAFIHKHGTGgNWIALPHKAGLNRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding41.14.1e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd  +  +    G++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.288590.1  69 GGFTQEEDNVICSLYSTIGSR-WAVIASQLP-GRTDNDVKNHWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.281962IPR017930Myb domain
SuperFamilySSF466892.11E-2711109IPR009057Homeodomain-like
SMARTSM007172.6E-111364IPR001005SANT/Myb domain
PfamPF002491.8E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-231569IPR009057Homeodomain-like
CDDcd001671.45E-81662No hitNo description
PROSITE profilePS5129420.0863117IPR017930Myb domain
SMARTSM007171.7E-1167115IPR001005SANT/Myb domain
PfamPF002491.4E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2370117IPR009057Homeodomain-like
CDDcd001677.76E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPQ EDATLTAFIH KHGTGGNWIA LPHKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG FTQEEDNVIC SLYSTIGSRW AVIASQLPGR TDNDVKNHWN TKLKKKFNSS  120
FSKPPNPIVV VTDPPRYSST STANSLKLHD DHEHNINTNF NMFSSHPPFD QIPMLNNNNN  180
PIIPELSTSS SSISLPIEQN HLEFSGPRSD EAADILQSYF HGVYENNNQY PYEDDVMDGF  240
D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141197110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2342570.0AC234257.1 Cucumis sativus chromosome 1 BAC clone ccbaa, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004135811.10.0PREDICTED: transcription factor RAX2-like
SwissprotQ9SJL71e-70RAX2_ARATH; Transcription factor RAX2
TrEMBLA0A0A0LZB20.0A0A0A0LZB2_CUCSA; Uncharacterized protein
STRINGGSMUA_Achr6P30830_0012e-75(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.12e-68myb domain protein 84
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]